Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA2D4 Peptide - C-terminal region

CACNA2D4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RCD4

UniProt

Q7Z3S7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CACNA2D4 Rabbit Polyclonal Antibody (orb584467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758952

Preservative

Lyophilized powder

AA Sequence

MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Benzoate-d5
TRC-S614001-50MG 50 mg

Sodium Benzoate-d5

Sign In for Pricing
View Details
RBP4 Antibody
KC-6036-01 50 μL

RBP4 Antibody

Sign In for Pricing
View Details
RBP4 Antibody
KC-6036-02 100 µL

RBP4 Antibody

Sign In for Pricing
View Details
RBP4 Antibody
KC-6036-03 1 mL

RBP4 Antibody

Sign In for Pricing
View Details
Human C9orf95 (NMRK1) activation kit by CRISPRa
GA110425 1 Kit

Human C9orf95 (NMRK1) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS807899 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details