Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNB2 Peptide - middle region

CACNB2 Peptide - middle region

Product Specifications

Product Name Alternative

CACNLB2, FLJ23743, MYSB, CAVB2

UniProt

Q6TME3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CACNB2 Rabbit Polyclonal Antibody (orb575555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_963891

Preservative

Lyophilized powder

AA Sequence

SRKSTPPSSGAKSADEQDQWKTAGLFWRFTTEHTPPYDVVPSMRPVVLVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMTD1 Protein Vector (Rat) (pPB-N-His)
PV261183 500 ng

COMTD1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit
MBS8804364-01 48 Strip Well

Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit

Sign In for Pricing
View Details
Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit
MBS8804364-02 96 Strip Well

Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit

Sign In for Pricing
View Details
Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit
MBS8804364-03 5x 96 Strip Well

Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit

Sign In for Pricing
View Details
Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit
MBS8804364-04 10x 96 Strip Well

Rat HbA1c (Glycated Hemoglobin A1c) ELISA Kit

Sign In for Pricing
View Details
Rat Cylicin 1 (CYLC1) ELISA kit
GTR10455971 96 Well

Rat Cylicin 1 (CYLC1) ELISA kit

Sign In for Pricing
View Details