Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacng1 Peptide - middle region

Cacng1 Peptide - middle region

Product Specifications

Product Name Alternative

Cacng, Cacng1

UniProt

P97707

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cacng1 Rabbit Polyclonal Antibody (orb575330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062128

Preservative

Lyophilized powder

AA Sequence

KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem106b Mouse siRNA Oligo Duplex (Locus ID 71900)
SR407890 1 Kit

Tmem106b Mouse siRNA Oligo Duplex (Locus ID 71900)

Sign In for Pricing
View Details
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody
MB4155 25 ul

LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody

Sign In for Pricing
View Details
Anti-Soluble Guanylyl Cyclase alpha 1 Antibody
STJ502969 100 µg

Anti-Soluble Guanylyl Cyclase alpha 1 Antibody

Sign In for Pricing
View Details
Recombinant Human Mucin-15/MUC15 (C-6His)
CA16-50ug 50 µg

Recombinant Human Mucin-15/MUC15 (C-6His)

Sign In for Pricing
View Details
Sheep Adipsin ELISA kit
GTR10396124 96 Well

Sheep Adipsin ELISA kit

Sign In for Pricing
View Details
MCM Antibody, mAb, Rabbit
A05403-100 100 µL

MCM Antibody, mAb, Rabbit

Sign In for Pricing
View Details