Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacng3 Peptide - C-terminal region

Cacng3 Peptide - C-terminal region

Product Specifications

UniProt

Q9JJV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cacng3 Rabbit Polyclonal Antibody (orb575401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062303

Preservative

Lyophilized powder

AA Sequence

GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)
TRV-0024463-01 200 µL

Biotin-Linked Polyclonal Antibody to Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)
TRV-0024463-02 1 mL

Biotin-Linked Polyclonal Antibody to Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)

Sign In for Pricing
View Details
PUMP1 Antibody
orb794660 2 mg

PUMP1 Antibody

Sign In for Pricing
View Details
Porcine Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit
MBS7227398-01 48 Well

Porcine Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit

Sign In for Pricing
View Details
Porcine Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit
MBS7227398-02 96 Well

Porcine Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit

Sign In for Pricing
View Details
Porcine Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit
MBS7227398-03 5x 96 Well

Porcine Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit

Sign In for Pricing
View Details