Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacng3 Peptide - C-terminal region

Cacng3 Peptide - C-terminal region

Product Specifications

UniProt

Q9JJV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cacng3 Rabbit Polyclonal Antibody (orb575401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062303

Preservative

Lyophilized powder

AA Sequence

GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin Basic Protein Rabbit pAb
A1664-01 20 µL

Myelin Basic Protein Rabbit pAb

Sign In for Pricing
View Details
Myelin Basic Protein Rabbit pAb
A1664-02 100 μL

Myelin Basic Protein Rabbit pAb

Sign In for Pricing
View Details
Myelin Basic Protein Rabbit pAb
A1664-03 1000 μL

Myelin Basic Protein Rabbit pAb

Sign In for Pricing
View Details
Myelin Basic Protein Rabbit pAb
A1664-04 500 μL

Myelin Basic Protein Rabbit pAb

Sign In for Pricing
View Details
Cdc25a ORF Vector (Rat) (pORF)
15602016 1.0 µg DNA

Cdc25a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative defensin-like protein 203 (At2g36255)
MBS1402524-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative defensin-like protein 203 (At2g36255)

Sign In for Pricing
View Details