Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacng8 Peptide - middle region

Cacng8 Peptide - middle region

Product Specifications

UniProt

Q8VHW2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cacng8 Rabbit Polyclonal Antibody (orb575461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573453

Preservative

Lyophilized powder

AA Sequence

ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1D sgRNA CRISPR Lentivector (Human) (Target 1)
K0151802 1.0 µg DNA

ATP6V1D sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Ibsp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3903006 1.0 µg DNA

Ibsp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-Human SMS Polyclonal Antibody
PHE94801 100 μg

Anti-Human SMS Polyclonal Antibody

Sign In for Pricing
View Details
Human CSDE1 (NM_001242892) AAV Particle
RC234895A1V 250 µL

Human CSDE1 (NM_001242892) AAV Particle

Sign In for Pricing
View Details
CNPY2 Protein Vector (Human) (pPM-C-HA)
PV010043 500 ng

CNPY2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PxpA Antibody
orb830018 2 mg

PxpA Antibody

Sign In for Pricing
View Details