Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacng8 Peptide - middle region

Cacng8 Peptide - middle region

Product Specifications

UniProt

Q8VHW2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cacng8 Rabbit Polyclonal Antibody (orb575461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573453

Preservative

Lyophilized powder

AA Sequence

ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

t-Butyl Mercaptan
06319-12 25 mL

t-Butyl Mercaptan

Sign In for Pricing
View Details
Anti-Neuroligin-1 Antibody (N97A/31)
HA321013-01 50 µg

Anti-Neuroligin-1 Antibody (N97A/31)

Sign In for Pricing
View Details
Anti-Neuroligin-1 Antibody (N97A/31)
HA321013-02 100 µg

Anti-Neuroligin-1 Antibody (N97A/31)

Sign In for Pricing
View Details
Anti-Neuroligin-1 Antibody (N97A/31)
HA321013-03 1 mg

Anti-Neuroligin-1 Antibody (N97A/31)

Sign In for Pricing
View Details
ZNF106 Rabbit Polyclonal Antibody
E53P02408 100 µL

ZNF106 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat Retinoblastoma-associated protein (Rb1), partial
MBS7110977-01 0.02 mg (E-Coli)

Recombinant Rat Retinoblastoma-associated protein (Rb1), partial

Sign In for Pricing
View Details