Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM3 Peptide - middle region

CADM3 Peptide - middle region

Product Specifications

Product Name Alternative

BIgR, FLJ10698, IGSF4B, NECL1, Necl-1, TSLL1, synCAM3

UniProt

Q8N126

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CADM3 Rabbit Polyclonal Antibody (orb580802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067012

Preservative

Lyophilized powder

AA Sequence

KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Liver Arginase Antibody
RC-16818-01 50 μL

Recombinant Liver Arginase Antibody

Sign In for Pricing
View Details
Recombinant Liver Arginase Antibody
RC-16818-02 100 µL

Recombinant Liver Arginase Antibody

Sign In for Pricing
View Details
Recombinant Liver Arginase Antibody
RC-16818-03 1 mL

Recombinant Liver Arginase Antibody

Sign In for Pricing
View Details
ANKRD18B (N-term) Rabbit Polyclonal Antibody
AP50184PU-N 400 µL

ANKRD18B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ptgds activation kit by CRISPRa
GA203450 1 Kit

Mouse Ptgds activation kit by CRISPRa

Sign In for Pricing
View Details
Erdosteine Homocysteine Impurity Sodium Salt
TRC-E596072-10MG 10 mg

Erdosteine Homocysteine Impurity Sodium Salt

Sign In for Pricing
View Details