Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALB1 Peptide - C-terminal region

CALB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALB

UniProt

P05937

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALB1 Rabbit Polyclonal Antibody (orb326328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004920

Preservative

Lyophilized powder

AA Sequence

EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cecum
CS712710 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
TCF12 Mouse Monoclonal Antibody [Clone ID: OTI2E11]
CF809698 100 µg

TCF12 Mouse Monoclonal Antibody [Clone ID: OTI2E11]

Sign In for Pricing
View Details
N-Acetyl-D-glucosamine
TRC-A178000-5G 5 g

N-Acetyl-D-glucosamine

Sign In for Pricing
View Details
LONRF3 (NM_001031855) Human Over-expression Lysate
LC400406 20 µg

LONRF3 (NM_001031855) Human Over-expression Lysate

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF640R conjugate, 0.1mg/mL
BNC402265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VGLUT1 Recombinant Mouse monoclonal Antibody
HA610217 100 µg

VGLUT1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details