Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALB1 Peptide - C-terminal region

CALB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALB

UniProt

P05937

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALB1 Rabbit Polyclonal Antibody (orb326328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004920

Preservative

Lyophilized powder

AA Sequence

EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAG3L1 (NM_001002840) Human Over-expression Lysate
LC424165 20 µg

STAG3L1 (NM_001002840) Human Over-expression Lysate

Sign In for Pricing
View Details
SDHAF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C12]
TA809693BM 100 µL

SDHAF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C12]

Sign In for Pricing
View Details
KIAA1970 (EARS2) Human Gene Knockout Kit (CRISPR)
KN421871 1 Kit

KIAA1970 (EARS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), Biotin conjugate, 0.1mg/mL
BNCB1654-500 1x 500 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM65 Antibody
KC-1919-01 50 μL

TRIM65 Antibody

Sign In for Pricing
View Details
TRIM65 Antibody
KC-1919-02 100 µL

TRIM65 Antibody

Sign In for Pricing
View Details