Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCOCO1 Peptide - N-terminal region

CALCOCO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cocoa, KIAA1536, PP13275, calphoglin

UniProt

Q9P1Z2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALCOCO1 Rabbit Polyclonal Antibody (orb326210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065949

Preservative

Lyophilized powder

AA Sequence

ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inpp5f Rat shRNA Lentiviral Particle (Locus ID 309008)
TL706108V 500 µL Each

Inpp5f Rat shRNA Lentiviral Particle (Locus ID 309008)

Sign In for Pricing
View Details
KRT75 Rabbit Polyclonal Antibody
orb184580-01 50 μL

KRT75 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRT75 Rabbit Polyclonal Antibody
orb184580-02 100 µL

KRT75 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRT75 Rabbit Polyclonal Antibody
orb184580-03 200 µL

KRT75 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Newcastle disease virus antibody
10-7872 1 mg

Newcastle disease virus antibody

Sign In for Pricing
View Details
1,4,6,7-Tetrahydro-7,7-dimethyl-5H-pyrazolo[4,3-c]pyridine-5-carboxylic acid, 1,1-dimethylethyl ester
OR1020920 1 Each

1,4,6,7-Tetrahydro-7,7-dimethyl-5H-pyrazolo[4,3-c]pyridine-5-carboxylic acid, 1,1-dimethylethyl ester

Sign In for Pricing
View Details