CALCOCO1 Peptide - N-terminal region
CALCOCO1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Cocoa, KIAA1536, PP13275, calphoglin
UniProt
Q9P1Z2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CALCOCO1 Rabbit Polyclonal Antibody (orb326210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065949
Preservative
Lyophilized powder
AA Sequence
ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6186705-01 0.1 mL
PRKAB1 (Protein Kinase, AMP-Activated, beta 1 non-Catalytic Subunit, AMPK, HAMPKb, MGC17785) (PE)
Sign In for Pricing
View Details MBS6186705-02 5x 0.1 mL
PRKAB1 (Protein Kinase, AMP-Activated, beta 1 non-Catalytic Subunit, AMPK, HAMPKb, MGC17785) (PE)
Sign In for Pricing
View Details 
MBS1014634-01 0.02 mg (E-Coli)
Recombinant Clostridium beijerinckii Bifunctional protein FolD (folD)
Sign In for Pricing
View Details MBS1014634-02 0.02 mg (Yeast)
Recombinant Clostridium beijerinckii Bifunctional protein FolD (folD)
Sign In for Pricing
View Details MBS1014634-03 0.1 mg (E-Coli)
Recombinant Clostridium beijerinckii Bifunctional protein FolD (folD)
Sign In for Pricing
View Details