CALR Peptide - middle region
CALR Peptide - middle region
Product Specifications
Product Name Alternative
CRT, FLJ26680, RO, SSA, cC1qR
UniProt
P27797
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CALR Rabbit Polyclonal Antibody (orb583880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004334
Preservative
Lyophilized powder
AA Sequence
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4718006 1.0 µg DNA
Slc17a9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
LS002100-100ug 100 µg
Estrogen Receptor beta (ESR2) (NM_001437) Human Over-expression Lysate
Sign In for Pricing
View Details 
RC229952L4V 200 µL
Apolipoprotein A V (APOA5) (NM_001166598) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details T01149-96-S 96 Tests
RT PCR test for detection of lipoprotein lipase gene mutation (1421C>G, rs328) (12 x 8 strip format)
Sign In for Pricing
View Details 
CABT-L2906-01 100 µl, 500 µl
Mouse Anti-Human NKX3.1 monoclonal antibody, clone JID751
Sign In for Pricing
View Details CABT-L2906-02 100 uL, 500 uL
Mouse Anti-Human NKX3.1 monoclonal antibody, clone JID751
Sign In for Pricing
View Details