Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALR Peptide - middle region

CALR Peptide - middle region

Product Specifications

Product Name Alternative

CRT, FLJ26680, RO, SSA, cC1qR

UniProt

P27797

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALR Rabbit Polyclonal Antibody (orb583880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004334

Preservative

Lyophilized powder

AA Sequence

PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp692 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV639498 1.0 µg DNA

Zfp692 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human MTHFD1 Pre-designed siRNA Set A
SI009981A 1 Each

Human MTHFD1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
UPF1 Antibody
orb1260365 100 µL

UPF1 Antibody

Sign In for Pricing
View Details
DYNC1I2 AAV siRNA Pooled Vector
18754161 1.0 µg

DYNC1I2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial
MBS7085144 Inquire

Recombinant Salmonella paratyphi A Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial

Sign In for Pricing
View Details
Mmu-miR-6930-5p miRNA Inhibitor
CIM1327-01 10 nmol

Mmu-miR-6930-5p miRNA Inhibitor

Sign In for Pricing
View Details