Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK1D Peptide - middle region

CAMK1D Peptide - middle region

Product Specifications

Product Name Alternative

CKLiK, CaM-K1, CaMKID

UniProt

Q8IU85

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMK1D Rabbit Polyclonal Antibody (orb330924) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_705718

Preservative

Lyophilized powder

AA Sequence

KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), Biotin conjugate, 0.1mg/mL
BNCB2587-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GEN1 Human Gene Knockout Kit (CRISPR)
KN421451 1 Kit

GEN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl 2-((3,5-Dichloropyridin-2-yl)amino)-2-oxoacetate
TRC-E355970-50MG 50 mg

Ethyl 2-((3,5-Dichloropyridin-2-yl)amino)-2-oxoacetate

Sign In for Pricing
View Details
MYC (Ab-62) Antibody
8B0020-AAT 50 µg

MYC (Ab-62) Antibody

Sign In for Pricing
View Details
TMED6 (Center) Rabbit Polyclonal Antibody
AP54285PU-N 400 µL

TMED6 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Live-or-DyeTM 375/600 Fixable Viability Staining Kit, Trial Size (50 assays)
#32014-T 1 Kit

Live-or-DyeTM 375/600 Fixable Viability Staining Kit, Trial Size (50 assays)

Sign In for Pricing
View Details