Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK1G Peptide - middle region

CAMK1G Peptide - middle region

Product Specifications

Product Name Alternative

CLICKIII, VWS1, dJ272L16.1

UniProt

Q96NX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMK1G Rabbit Polyclonal Antibody (orb583559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065172

Preservative

Lyophilized powder

AA Sequence

KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A1 (N-terminal region) Antibody
bsm-70333M 100 µL

ALDH1A1 (N-terminal region) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal LHR Antibody (LHCGR/1415) [DyLight 594]
NBP2-54494DL594 0.1 mL

Mouse Monoclonal LHR Antibody (LHCGR/1415) [DyLight 594]

Sign In for Pricing
View Details
Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)
MBS1148949-01 0.02 mg (E-Coli)

Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)

Sign In for Pricing
View Details
Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)
MBS1148949-02 0.1 mg (E-Coli)

Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)

Sign In for Pricing
View Details
Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)
MBS1148949-03 0.02 mg (Yeast)

Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)

Sign In for Pricing
View Details
Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)
MBS1148949-04 0.1 mg (Yeast)

Recombinant Drosophila mojavensis Protein N-terminal glutamine amidohydrolase (tun)

Sign In for Pricing
View Details