Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK1G Peptide - middle region

CAMK1G Peptide - middle region

Product Specifications

Product Name Alternative

CLICKIII, VWS1, dJ272L16.1

UniProt

Q96NX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMK1G Rabbit Polyclonal Antibody (orb583559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065172

Preservative

Lyophilized powder

AA Sequence

KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UBTD2 Antibody [PerCP]
NBP2-98563PCP 0.1 mL

Rabbit Polyclonal UBTD2 Antibody [PerCP]

Sign In for Pricing
View Details
Protein SET (SET) Peptide
abx269048 100 µg

Protein SET (SET) Peptide

Sign In for Pricing
View Details
Kir4.1 Antibody (PerCP)
abx445835 100 µg

Kir4.1 Antibody (PerCP)

Sign In for Pricing
View Details
MALT1 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62898R-PE-Cy5.5 100 µL

MALT1 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
NR1D1 Antibody Blocking Peptide
orb1507600 500 µg

NR1D1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Rabbit anti-KCNK9 Antibody
MBS4508387-01 0.05 mL

Rabbit anti-KCNK9 Antibody

Sign In for Pricing
View Details