Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK4 Peptide - C-terminal region

CAMK4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CaMK-GR, MGC36771, IV, caMK, CaMK IV

UniProt

Q16566

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMK4 Rabbit Polyclonal Antibody (orb584995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001735

Preservative

Lyophilized powder

AA Sequence

ARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Duodenum
CS700818 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details
Caspase 3 (CASP3) (NM_032991) Human Tagged ORF Clone Lentiviral Particle
RC204444L4V 200 µL

Caspase 3 (CASP3) (NM_032991) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PGBD1 polyclonal antibody
BS67613-01 50 µL

PGBD1 polyclonal antibody

Sign In for Pricing
View Details
PGBD1 polyclonal antibody
BS67613-02 100 µL

PGBD1 polyclonal antibody

Sign In for Pricing
View Details
USP7i-1
MBS3601579-01 2 mg

USP7i-1

Sign In for Pricing
View Details
USP7i-1
MBS3601579-02 5 mg

USP7i-1

Sign In for Pricing
View Details