CANX Peptide - middle region
CANX Peptide - middle region
Product Specifications
Product Name Alternative
CNX, FLJ26570, IP90, P90
UniProt
P27824
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CANX Rabbit Polyclonal Antibody (orb331067) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001737
Preservative
Lyophilized powder
AA Sequence
LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH033944-01 10 µg
Recombinant Human IL-7 Receptor Subunit alpha/IL-7RA/CD127 (C-6His)
Sign In for Pricing
View Details PKSH033944-02 50 µg
Recombinant Human IL-7 Receptor Subunit alpha/IL-7RA/CD127 (C-6His)
Sign In for Pricing
View Details 
BNC681868-100 1x 100 µL
Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-M0166-01 5x 96 Tests
Uncoated Mouse AChE (Acetylcholinesterase) ELISA Kit
Sign In for Pricing
View Details