Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN1 Peptide - N-terminal region

CAPN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CANP, CANP1, CANPL1, muCANP, muCL

UniProt

P07384

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN1 Rabbit Polyclonal Antibody (orb331114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005177

Preservative

Lyophilized powder

AA Sequence

EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Vascular Endothelial cell Growth Factor receptor 1,VEGFR-1 ELISA KIT
JOT-EK0125Sh-01 96 Well

Sheep Vascular Endothelial cell Growth Factor receptor 1,VEGFR-1 ELISA KIT

Sign In for Pricing
View Details
Sheep Vascular Endothelial cell Growth Factor receptor 1,VEGFR-1 ELISA KIT
JOT-EK0125Sh-02 48 Well

Sheep Vascular Endothelial cell Growth Factor receptor 1,VEGFR-1 ELISA KIT

Sign In for Pricing
View Details
PDDC1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
36273126 3x 1.0µg DNA

PDDC1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
MBS3 3'UTR GFP Stable Cell Line
TU063084 1.0 mL

MBS3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CDC37L1 Polyclonal Antibody, FITC Conjugated
bs-9074R-FITC 100 µL

CDC37L1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Metallothionein 2 (MT2)
MBS2117335-01 1 mL

APC-Cy7 Linked Polyclonal Antibody to Metallothionein 2 (MT2)

Sign In for Pricing
View Details