Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD10 Peptide - C-terminal region

CARD10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BIMP1, CARMA3, MGC142219

UniProt

P62750

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD10 Rabbit Polyclonal Antibody (orb585139) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000975

Preservative

Lyophilized powder

AA Sequence

RVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAAM1 Human Gene Knockout Kit (CRISPR)
KN417675 1 Kit

DAAM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (CD68/G2), CF488A conjugate, 0.1mg/mL
BNC880919-100 1x 100 µL

CD68 (CD68/G2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG217), CF568 conjugate, 0.1mg/mL
BNC680217-500 1x 500 µL

Human IgG Immunoglobulin (IG217), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human NME2 (NME1-NME2) activation kit by CRISPRa
GA118872 1 Kit

Human NME2 (NME1-NME2) activation kit by CRISPRa

Sign In for Pricing
View Details
KCNE2 (NM_172201) Human Recombinant Protein
TP311320M 100 µg

KCNE2 (NM_172201) Human Recombinant Protein

Sign In for Pricing
View Details
MFAP5 Antibody (Biotin)
KB-3693-01 50 μL

MFAP5 Antibody (Biotin)

Sign In for Pricing
View Details