Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD10 Peptide - C-terminal region

CARD10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BIMP1, CARMA3, MGC142219

UniProt

P62750

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD10 Rabbit Polyclonal Antibody (orb585139) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000975

Preservative

Lyophilized powder

AA Sequence

RVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPP2 (C-term) Rabbit Polyclonal Antibody
AP54478PU-N 400 µL

UPP2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Portable Ion Chromatography BCHR-106
BCHR-106 1 Unit

Portable Ion Chromatography BCHR-106

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), 0.2mg/mL
BNUB1561-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), 0.2mg/mL

Sign In for Pricing
View Details
Proteinase K, 1ml
PC0712-1ml 1 mL

Proteinase K, 1ml

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS703017 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
1-(Alpha,Alpha,Alpha-Trifluoro-m-tolyl)piperazine Hydrochloride
TRC-T793500-1G 1 g

1-(Alpha,Alpha,Alpha-Trifluoro-m-tolyl)piperazine Hydrochloride

Sign In for Pricing
View Details