Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD17 Peptide - middle region

CARD17 Peptide - middle region

Product Specifications

Product Name Alternative

INCA

UniProt

Q5XLA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD17 Rabbit Polyclonal Antibody (orb584936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007233

Preservative

Lyophilized powder

AA Sequence

MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS15 (SCAF4) (NM_001145444) Human Over-expression Lysate
LY428891 100 µg

SFRS15 (SCAF4) (NM_001145444) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (S477R) (His Tag)
PKSV030456 100 µg

Recombinant SARS-CoV-2 Spike RBD (S477R) (His Tag)

Sign In for Pricing
View Details
SEC31B Human Gene Knockout Kit (CRISPR)
KN424858 1 Kit

SEC31B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycine
TRC-G615990-10MG 10 mg

Glycine

Sign In for Pricing
View Details
Palladium(II) Acetylacetonate
TRC-P578015-2.5G 2.5 g

Palladium(II) Acetylacetonate

Sign In for Pricing
View Details
ZNF394 antibody
FNab09694 100 µg

ZNF394 antibody

Sign In for Pricing
View Details