Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD17 Peptide - middle region

CARD17 Peptide - middle region

Product Specifications

Product Name Alternative

INCA

UniProt

Q5XLA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD17 Rabbit Polyclonal Antibody (orb584936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007233

Preservative

Lyophilized powder

AA Sequence

MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFIH1 Rabbit Monoclonal Antibody [Clone ID: 24GB6085]
TA424878 100 µL

IFIH1 Rabbit Monoclonal Antibody [Clone ID: 24GB6085]

Sign In for Pricing
View Details
TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI1C9]
CF809532 100 µg

TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI1C9]

Sign In for Pricing
View Details
TIMP3 Recombinant Rabbit Monoclonal Antibody [PSH04-41]
HA722126 100 µL

TIMP3 Recombinant Rabbit Monoclonal Antibody [PSH04-41]

Sign In for Pricing
View Details
GNS Rabbit Polyclonal Antibody
AP17435PU-N 400 µL

GNS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NF2 Rabbit Polyclonal Antibody
AP02759PU-N 100 µL

NF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Laburnum alpinum Lectin (Scotch Laburnum) -LAA-
LA-5301-1 1 mg

Alkaline Phosphatase Conjugated Laburnum alpinum Lectin (Scotch Laburnum) -LAA-

Sign In for Pricing
View Details