Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD9 Peptide - middle region

CARD9 Peptide - middle region

Product Specifications

Product Name Alternative

HCARD9, CANDF2

UniProt

Q9H257

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD9 Rabbit Polyclonal Antibody (orb583675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_434700

Preservative

Lyophilized powder

AA Sequence

ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL27 siRNA (Human)
MBS8234602-01 15 nmol

RPL27 siRNA (Human)

Sign In for Pricing
View Details
RPL27 siRNA (Human)
MBS8234602-02 30 nmol

RPL27 siRNA (Human)

Sign In for Pricing
View Details
RPL27 siRNA (Human)
MBS8234602-03 5x 30 nmol

RPL27 siRNA (Human)

Sign In for Pricing
View Details
P2RY4 (NRU, P2P, UNR, P2Y4, P2Y Purinoceptor 4) (MaxLight 405)
MBS6430263-01 0.1 mL

P2RY4 (NRU, P2P, UNR, P2Y4, P2Y Purinoceptor 4) (MaxLight 405)

Sign In for Pricing
View Details
P2RY4 (NRU, P2P, UNR, P2Y4, P2Y Purinoceptor 4) (MaxLight 405)
MBS6430263-02 5x 0.1 mL

P2RY4 (NRU, P2P, UNR, P2Y4, P2Y Purinoceptor 4) (MaxLight 405)

Sign In for Pricing
View Details
p53 Blocking Peptide
abx063381-01 1 mg

p53 Blocking Peptide

Sign In for Pricing
View Details