Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD9 Peptide - middle region

CARD9 Peptide - middle region

Product Specifications

Product Name Alternative

HCARD9, CANDF2

UniProt

Q9H257

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD9 Rabbit Polyclonal Antibody (orb583675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_434700

Preservative

Lyophilized powder

AA Sequence

ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 3- (aminomethyl) bicyclo[1.1.1]pentane-1-carboxylate hydrochloride
NQC76128-01 50 mg

Methyl 3- (aminomethyl) bicyclo[1.1.1]pentane-1-carboxylate hydrochloride

Sign In for Pricing
View Details
Methyl 3- (aminomethyl) bicyclo[1.1.1]pentane-1-carboxylate hydrochloride
NQC76128-02 0.5 g

Methyl 3- (aminomethyl) bicyclo[1.1.1]pentane-1-carboxylate hydrochloride

Sign In for Pricing
View Details
Recombinant Human AHSA2 Protein - (Dry Ice)
H00130872-P01-25ug 25 µg

Recombinant Human AHSA2 Protein - (Dry Ice)

Sign In for Pricing
View Details
HLCS Antibody - C-terminal region : FITC (ARP74943_P050-FITC)
ARP74943_P050-FITC 100 µL

HLCS Antibody - C-terminal region : FITC (ARP74943_P050-FITC)

Sign In for Pricing
View Details
C1QTNF6 Antibody
MBS7001366-01 0.05 mg

C1QTNF6 Antibody

Sign In for Pricing
View Details
C1QTNF6 Antibody
MBS7001366-02 0.1 mg

C1QTNF6 Antibody

Sign In for Pricing
View Details