Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - middle region

CASP1 Peptide - middle region

Product Specifications

Product Name Alternative

ICE, IL1BC, P45

UniProt

P29466

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP1 Rabbit Polyclonal Antibody (orb333727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001214

Preservative

Lyophilized powder

AA Sequence

LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Receptor (phospho-S400) Blocking Peptide
orb706371-01 1 mg

Progesterone Receptor (phospho-S400) Blocking Peptide

Sign In for Pricing
View Details
Progesterone Receptor (phospho-S400) Blocking Peptide
orb706371-02 5 mg

Progesterone Receptor (phospho-S400) Blocking Peptide

Sign In for Pricing
View Details
XylT-I Lentiviral Activation Particles (h)
sc-404590-LAC 200 µL

XylT-I Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Mapre2 (NM_001162942) Mouse Tagged ORF Clone
MG219307 10 µg

Mapre2 (NM_001162942) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human IL33 Matched Antibody Pair Set [ABP-S-03216]
ABP-S-03216 5 Plates

Human IL33 Matched Antibody Pair Set [ABP-S-03216]

Sign In for Pricing
View Details
Anti-LDLR Antibody-PerCP (3N325)
TMAY-03221C-01 25 Tests

Anti-LDLR Antibody-PerCP (3N325)

Sign In for Pricing
View Details