Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP10 Peptide - middle region

CASP10 Peptide - middle region

Product Specifications

Product Name Alternative

ALPS2, FLICE2, MCH4

UniProt

Q92851

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001221

Preservative

Lyophilized powder

AA Sequence

HNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIP

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 790
DL87641A-01 100 µL

Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 790

Sign In for Pricing
View Details
Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 790
DL87641A-02 500 µL

Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 790

Sign In for Pricing
View Details
Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 790
DL87641A-03 1 mL

Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 790

Sign In for Pricing
View Details
Olfr1205 Mouse shRNA Lentiviral Particle (Locus ID 258898)
TL507943V 500 µL Each

Olfr1205 Mouse shRNA Lentiviral Particle (Locus ID 258898)

Sign In for Pricing
View Details
IDDM9 siRNA Oligos set (Human)
24184171 3x 5 nmol

IDDM9 siRNA Oligos set (Human)

Sign In for Pricing
View Details
VILL Peptide - N-terminal region (AAP63465)
AAP63465-100UG 100 µg

VILL Peptide - N-terminal region (AAP63465)

Sign In for Pricing
View Details