Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP4 Peptide - middle region

CASP4 Peptide - middle region

Product Specifications

Product Name Alternative

ICE (rel) II, ICEREL-II, ICH-2, Mih1/TX, TX

UniProt

P49662

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP4 Rabbit Polyclonal Antibody (orb331011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001216

Preservative

Lyophilized powder

AA Sequence

GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 (v-akt Murine Thymoma Viral Oncogene Homolog 1, AKT, MGC99656, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA) (HRP)
243218-HRP 100 µL

AKT1 (v-akt Murine Thymoma Viral Oncogene Homolog 1, AKT, MGC99656, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA) (HRP)

Sign In for Pricing
View Details
LCAP Rabbit Polyclonal Antibody
MBS9515238-01 0.05 mL

LCAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LCAP Rabbit Polyclonal Antibody
MBS9515238-02 0.1 mL

LCAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LCAP Rabbit Polyclonal Antibody
MBS9515238-03 5x 0.1 mL

LCAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Estrogen Receptor, alpha (ER) discontinued
E3565-10T 100 µg

Estrogen Receptor, alpha (ER) discontinued

Sign In for Pricing
View Details
Anti-TGF β1/3 Rabbit Monoclonal Antibody
M00019-11-100μl 100 µL

Anti-TGF β1/3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details