CASP5 Peptide - middle region
CASP5 Peptide - middle region
Product Specifications
Product Name Alternative
ICE (rel) III, ICEREL-III, ICH-3, MGC141966
UniProt
P51878
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CASP5 Rabbit Polyclonal Antibody (orb584189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129581
Preservative
Lyophilized powder
AA Sequence
VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1355338-01 0.02 mg (E-Coli)
Recombinant Lactobacillus salivarius S-ribosylhomocysteine lyase (luxS)
Sign In for Pricing
View Details MBS1355338-02 0.1 mg (E-Coli)
Recombinant Lactobacillus salivarius S-ribosylhomocysteine lyase (luxS)
Sign In for Pricing
View Details MBS1355338-03 0.02 mg (Yeast)
Recombinant Lactobacillus salivarius S-ribosylhomocysteine lyase (luxS)
Sign In for Pricing
View Details MBS1355338-04 0.1 mg (Yeast)
Recombinant Lactobacillus salivarius S-ribosylhomocysteine lyase (luxS)
Sign In for Pricing
View Details MBS1355338-05 0.02 mg (Baculovirus)
Recombinant Lactobacillus salivarius S-ribosylhomocysteine lyase (luxS)
Sign In for Pricing
View Details MBS1355338-06 0.02 mg (Mammalian-Cell)
Recombinant Lactobacillus salivarius S-ribosylhomocysteine lyase (luxS)
Sign In for Pricing
View Details