Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP6 Peptide - middle region

CASP6 Peptide - middle region

Product Specifications

Product Name Alternative

MCH2

UniProt

P55212

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP6 Rabbit Polyclonal Antibody (orb584190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001217

Preservative

Lyophilized powder

AA Sequence

QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF431 Rabbit pAb, IRDye 800CW conjugated
orb2857893 100 µL

ZNF431 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Rab5b Antibody [HRP]
NBP2-99625H 0.1 mL

Rabbit Polyclonal Rab5b Antibody [HRP]

Sign In for Pricing
View Details
Lentiviral mouse Pcsk6 shRNA (UAS) - Lentiviral mouse Pcsk6 shRNA (UAS, iRFP) (25)
GTR15237638 1 Vial

Lentiviral mouse Pcsk6 shRNA (UAS) - Lentiviral mouse Pcsk6 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
FABP5 Antibody
A21144-100UL 100 µL

FABP5 Antibody

Sign In for Pricing
View Details
Rat Glucocorticoid-Induced Transcript 1 Protein (GLCCI1) ELISA Kit
MBS9944965-01 48 Well

Rat Glucocorticoid-Induced Transcript 1 Protein (GLCCI1) ELISA Kit

Sign In for Pricing
View Details
Rat Glucocorticoid-Induced Transcript 1 Protein (GLCCI1) ELISA Kit
MBS9944965-02 96 Well

Rat Glucocorticoid-Induced Transcript 1 Protein (GLCCI1) ELISA Kit

Sign In for Pricing
View Details