Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP6 Peptide - middle region

CASP6 Peptide - middle region

Product Specifications

Product Name Alternative

MCH2

UniProt

P55212

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP6 Rabbit Polyclonal Antibody (orb584190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001217

Preservative

Lyophilized powder

AA Sequence

QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B-lymphocyte antigen (CD20; B-lym) ELISA Kit
YP-W14618-01 48 Tests

Human B-lymphocyte antigen (CD20; B-lym) ELISA Kit

Sign In for Pricing
View Details
Human B-lymphocyte antigen (CD20; B-lym) ELISA Kit
YP-W14618-02 96 Tests

Human B-lymphocyte antigen (CD20; B-lym) ELISA Kit

Sign In for Pricing
View Details
Human SCRN3 shRNA Plasmid
abx962442-01 150 µg

Human SCRN3 shRNA Plasmid

Sign In for Pricing
View Details
Human SCRN3 shRNA Plasmid
abx962442-02 300 µg

Human SCRN3 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Anti TP53 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence) 200ul
IRBAMLTP53AP674200UL 200 µL

Rabbit Anti TP53 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence) 200ul

Sign In for Pricing
View Details
Recombinant Chara vulgaris Photosystem I assembly protein Ycf4 (ycf4), partial
MBS7074486 Inquire

Recombinant Chara vulgaris Photosystem I assembly protein Ycf4 (ycf4), partial

Sign In for Pricing
View Details