Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBLN1 Peptide - C-terminal region

CBLN1 Peptide - C-terminal region

Product Specifications

UniProt

P23435

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBLN1 Rabbit Polyclonal Antibody (orb584396) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004343

Preservative

Lyophilized powder

AA Sequence

LMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGTA Human Gene Knockout Kit (CRISPR)
KN201429LP 1 Kit

SGTA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AXL (C-term) Rabbit Polyclonal Antibody
AP14269PU-N 400 µL

AXL (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apalutamide-d3
TRC-A726123-5MG 5 mg

Apalutamide-d3

Sign In for Pricing
View Details
Calreticulin (CALR) Rabbit Polyclonal Antibody
AP33519PU-N 400 µL

Calreticulin (CALR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant AGXT Antibody
RC-4424-01 50 μL

Recombinant AGXT Antibody

Sign In for Pricing
View Details
Recombinant AGXT Antibody
RC-4424-02 100 µL

Recombinant AGXT Antibody

Sign In for Pricing
View Details