Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBLN1 Peptide - C-terminal region

CBLN1 Peptide - C-terminal region

Product Specifications

UniProt

P23435

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBLN1 Rabbit Polyclonal Antibody (orb584396) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004343

Preservative

Lyophilized powder

AA Sequence

LMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO-1 (SUMO1/1188), CF647 conjugate, 0.1mg/mL
BNC471188-500 1x 500 µL

SUMO-1 (SUMO1/1188), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyanine 3 Bihexanoic Acid Dye, Potassium Salt
TRC-C958450-1MG 1 mg

Cyanine 3 Bihexanoic Acid Dye, Potassium Salt

Sign In for Pricing
View Details
MemBrite® Fix 543/560 Cell Surface Staining Kit, 100 Reactions
#30094-T 1 Kit

MemBrite® Fix 543/560 Cell Surface Staining Kit, 100 Reactions

Sign In for Pricing
View Details
WTAP (NM_152858) Human Recombinant Protein
TP323099L 1 mg

WTAP (NM_152858) Human Recombinant Protein

Sign In for Pricing
View Details
REA (PHB2) Rabbit Monoclonal Antibody [Clone ID: R01-5J9]
TA384972 100 µL

REA (PHB2) Rabbit Monoclonal Antibody [Clone ID: R01-5J9]

Sign In for Pricing
View Details
METTL3 Antibody
KC-47503-01 50 μL

METTL3 Antibody

Sign In for Pricing
View Details