CBX2 Peptide - middle region
CBX2 Peptide - middle region
Product Specifications
Product Name Alternative
CDCA6, M33, MGC10561, SRXY5
UniProt
Q14781
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CBX2 Rabbit Polyclonal Antibody (orb583975) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005180
Preservative
Lyophilized powder
AA Sequence
SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040747-500 1x 500 µL
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683007-500 1x 500 µL
VISTA / B7-H5 / VSIR (Negative Regulator of Immune Response) (VISTA/3007), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942259-100 1x 100 µL
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 