Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX2 Peptide - middle region

CBX2 Peptide - middle region

Product Specifications

Product Name Alternative

CDCA6, M33, MGC10561, SRXY5

UniProt

Q14781

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBX2 Rabbit Polyclonal Antibody (orb583975) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005180

Preservative

Lyophilized powder

AA Sequence

SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzeneacetonitrile
TRC-B188790-50G 50 g

Benzeneacetonitrile

Sign In for Pricing
View Details
POLR1B (NM_019014) Human Over-expression Lysate
LY402726 100 µg

POLR1B (NM_019014) Human Over-expression Lysate

Sign In for Pricing
View Details
Mini Sample Human GDF15 (Growth Differentiation Factor 15) ELISA Kit
E-MSEL-H0014-01 24 Tests

Mini Sample Human GDF15 (Growth Differentiation Factor 15) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human GDF15 (Growth Differentiation Factor 15) ELISA Kit
E-MSEL-H0014-02 48 Tests

Mini Sample Human GDF15 (Growth Differentiation Factor 15) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human GDF15 (Growth Differentiation Factor 15) ELISA Kit
E-MSEL-H0014-03 96 Tests

Mini Sample Human GDF15 (Growth Differentiation Factor 15) ELISA Kit

Sign In for Pricing
View Details
2-Bromobenzaldehyde
TRC-B680115-25G 25 g

2-Bromobenzaldehyde

Sign In for Pricing
View Details