Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCBE1 Peptide - middle region

CCBE1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ30681, MGC50861

UniProt

Q6UXH8

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCBE1 Rabbit Polyclonal Antibody (orb581754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597716

Preservative

Lyophilized powder

AA Sequence

PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCP1 Polyclonal Antibody
MBS9133544-01 0.02 mL

LCP1 Polyclonal Antibody

Sign In for Pricing
View Details
LCP1 Polyclonal Antibody
MBS9133544-02 0.1 mL

LCP1 Polyclonal Antibody

Sign In for Pricing
View Details
LCP1 Polyclonal Antibody
MBS9133544-03 5x 0.1 mL

LCP1 Polyclonal Antibody

Sign In for Pricing
View Details
DNMT3B Protein Vector (Mouse) (pPM-C-His)
PV172993 500 ng

DNMT3B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana FACT complex subunit SPT16
MBS969617-01 0.05 mg (E-Coli)

Recombinant Arabidopsis thaliana FACT complex subunit SPT16

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana FACT complex subunit SPT16
MBS969617-02 0.05 mg (Yeast)

Recombinant Arabidopsis thaliana FACT complex subunit SPT16

Sign In for Pricing
View Details