Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCBE1 Peptide - middle region

CCBE1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ30681, MGC50861

UniProt

Q6UXH8

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCBE1 Rabbit Polyclonal Antibody (orb581754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597716

Preservative

Lyophilized powder

AA Sequence

PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APPBP1 Rabbit Polyclonal Antibody (PE-Cy7)
orb922460 100 µL

APPBP1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
RLBP1 Antibody
orb2672573-01 50 µL

RLBP1 Antibody

Sign In for Pricing
View Details
RLBP1 Antibody
orb2672573-02 100 µL

RLBP1 Antibody

Sign In for Pricing
View Details
RLBP1 Antibody
orb2672573-03 200 µL

RLBP1 Antibody

Sign In for Pricing
View Details
OAZ3 (Ornithine Decarboxylase Antizyme 3, AZ3, OAZ-t, TISP15)
553763 50 µg

OAZ3 (Ornithine Decarboxylase Antizyme 3, AZ3, OAZ-t, TISP15)

Sign In for Pricing
View Details
UBQLN2, 1-624aa, Human, His tag, E Coli
MBS206258-01 0.02 mg

UBQLN2, 1-624aa, Human, His tag, E Coli

Sign In for Pricing
View Details