Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC102B Peptide - N-terminal region

CCDC102B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACY1L, AN, C18orf14, DKFZp434K1426, DKFZp686I08254, FLJ23594, HsT1731, MGC161726, MGC161728

UniProt

A1A4H1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC102B Rabbit Polyclonal Antibody (orb585419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079057

Preservative

Lyophilized powder

AA Sequence

TANWREKWSKVRAERNSAREEGRQLRIKLEMAMKELSTLKKKQSLPPQKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r186 Mouse Gene Knockout Kit (CRISPR)
KN518977 1 Kit

Vmn1r186 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS506003 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
CD32 (Fc Gamma RIIa) (FCGR2A/479), Biotin conjugate, 0.1mg/mL
BNCB0479-100 1x 100 µL

CD32 (Fc Gamma RIIa) (FCGR2A/479), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CEACAM4 Human Gene Knockout Kit (CRISPR)
KN420740 1 Kit

CEACAM4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Magnetic Polystyrene AM NH₂
HMAG10002.1G 1 g

Magnetic Polystyrene AM NH₂

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details