Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC102B Peptide - N-terminal region

CCDC102B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACY1L, AN, C18orf14, DKFZp434K1426, DKFZp686I08254, FLJ23594, HsT1731, MGC161726, MGC161728

UniProt

A1A4H1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC102B Rabbit Polyclonal Antibody (orb585419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079057

Preservative

Lyophilized powder

AA Sequence

TANWREKWSKVRAERNSAREEGRQLRIKLEMAMKELSTLKKKQSLPPQKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Disperse Orange 3 (Technical Grade)
TRC-D493485-1G 1 g

Disperse Orange 3 (Technical Grade)

Sign In for Pricing
View Details
Human RNase H2 subunit C (RNASEH2C) activation kit by CRISPRa
GA113396 1 Kit

Human RNase H2 subunit C (RNASEH2C) activation kit by CRISPRa

Sign In for Pricing
View Details
Pyruvic Acid-13C Sodium Salt
TRC-P998896-500MG 500 mg

Pyruvic Acid-13C Sodium Salt

Sign In for Pricing
View Details
Rptn Mouse Gene Knockout Kit (CRISPR)
KN515121 1 Kit

Rptn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,2-Bis-(4-hydroxyphenyl)hexafluoropropane Monosulfate Sodium Salt
TRC-B446685-25MG 25 mg

2,2-Bis-(4-hydroxyphenyl)hexafluoropropane Monosulfate Sodium Salt

Sign In for Pricing
View Details
Rab32 Mouse Gene Knockout Kit (CRISPR)
KN514353 1 Kit

Rab32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details