Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC110 Peptide - middle region

CCDC110 Peptide - middle region

Product Specifications

Product Name Alternative

KM-HN-1, KMHN1, MGC33607, CT52

UniProt

Q8TBZ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC110 Rabbit Polyclonal Antibody (orb582797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689988

Preservative

Lyophilized powder

AA Sequence

KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YM 2447690
TRC-Y100565-500MG 500 mg

YM 2447690

Sign In for Pricing
View Details
Recombinant CD26 Antibody
RC-5649-01 50 μL

Recombinant CD26 Antibody

Sign In for Pricing
View Details
Recombinant CD26 Antibody
RC-5649-02 100 µL

Recombinant CD26 Antibody

Sign In for Pricing
View Details
Recombinant CD26 Antibody
RC-5649-03 1 mL

Recombinant CD26 Antibody

Sign In for Pricing
View Details
FAM54A (MTFR2) (NM_001099286) Human Recombinant Protein
TP760724 50 µg

FAM54A (MTFR2) (NM_001099286) Human Recombinant Protein

Sign In for Pricing
View Details
5-Chloro-1,2-dihydro-1-acenaphthylenol
TRC-C364260-25MG 25 mg

5-Chloro-1,2-dihydro-1-acenaphthylenol

Sign In for Pricing
View Details