Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUS10 Peptide - middle region

PUS10 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ32312, MGC126729, MGC126755, DOBI, CCDC139

UniProt

Q3MIT2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_653310

Preservative

Lyophilized powder

AA Sequence

AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r181 Mouse Gene Knockout Kit (CRISPR)
KN518973 1 Kit

Vmn1r181 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS503962 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details
CX3CR1 Mouse Monoclonal Antibody [Clone ID: 1G4]
AM26731PU-N 100 µg

CX3CR1 Mouse Monoclonal Antibody [Clone ID: 1G4]

Sign In for Pricing
View Details
Human HSP-70/HSPA9 (Heat Shock 70 kDa Protein 9) ELISA Kit
E-EL-H1863-01 24 Tests

Human HSP-70/HSPA9 (Heat Shock 70 kDa Protein 9) ELISA Kit

Sign In for Pricing
View Details
Human HSP-70/HSPA9 (Heat Shock 70 kDa Protein 9) ELISA Kit
E-EL-H1863-02 48 Tests

Human HSP-70/HSPA9 (Heat Shock 70 kDa Protein 9) ELISA Kit

Sign In for Pricing
View Details
Human HSP-70/HSPA9 (Heat Shock 70 kDa Protein 9) ELISA Kit
E-EL-H1863-03 96 Tests

Human HSP-70/HSPA9 (Heat Shock 70 kDa Protein 9) ELISA Kit

Sign In for Pricing
View Details