Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC68 Peptide - middle region

CCDC68 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25368, SE57-1

UniProt

Q9H2F9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC68 Rabbit Polyclonal Antibody (orb585420) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079490

Preservative

Lyophilized powder

AA Sequence

EAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Notch 2 Rabbit Polyclonal Antibody (HRP)
orb1599331 100 µL

Notch 2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TUBA1C Protein Vector (Rat) (pPB-C-His)
PV313678 500 ng

TUBA1C Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Outer Surface Protein C (OspC), Strain B31, Recombinant, Borrelia burgdorferi, MBP-Tag discontinued
519029 100 µg

Outer Surface Protein C (OspC), Strain B31, Recombinant, Borrelia burgdorferi, MBP-Tag discontinued

Sign In for Pricing
View Details
CDY24P ORF Vector (Human) (pORF)
ORF017185 1.0 µg DNA

CDY24P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Nori® Rabbit A1AT ELISA Kit
GR144392 96 Well

Nori® Rabbit A1AT ELISA Kit

Sign In for Pricing
View Details
CD3EAP siRNA (Human)
CRH7389-01 15 nmol

CD3EAP siRNA (Human)

Sign In for Pricing
View Details