Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC76 Peptide - N-terminal region

CCDC76 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10287, FLJ11219, CCDC76

UniProt

Q9NUP7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC76 Rabbit Polyclonal Antibody (orb326187) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061956

Preservative

Lyophilized powder

AA Sequence

QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B10]
TA808990BM 100 µL

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B10]

Sign In for Pricing
View Details
Human C15orf15 (RSL24D1) activation kit by CRISPRa
GA109635 1 Kit

Human C15orf15 (RSL24D1) activation kit by CRISPRa

Sign In for Pricing
View Details
2-Hydroxyethanesulfonic Acid (80% w/w in Water)
TRC-H553395-1G 1 g

2-Hydroxyethanesulfonic Acid (80% w/w in Water)

Sign In for Pricing
View Details
RWDD3 Human Gene Knockout Kit (CRISPR)
KN417602 1 Kit

RWDD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OR2J3 activation kit by CRISPRa
GA118540 1 Kit

Human OR2J3 activation kit by CRISPRa

Sign In for Pricing
View Details
TentaGel® TOPPA
S30902.012023.5G 5 g

TentaGel® TOPPA

Sign In for Pricing
View Details