Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC76 Peptide - N-terminal region

CCDC76 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10287, FLJ11219, CCDC76

UniProt

Q9NUP7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC76 Rabbit Polyclonal Antibody (orb326187) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061956

Preservative

Lyophilized powder

AA Sequence

QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF647 conjugate, 0.1mg/mL
BNC472041-500 1x 500 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPATA16 (NM_031955) Human Recombinant Protein
TP760135 50 µg

SPATA16 (NM_031955) Human Recombinant Protein

Sign In for Pricing
View Details
NDUFB3 Polyclonal Antibody
E-AB-18336-01 20 µL

NDUFB3 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFB3 Polyclonal Antibody
E-AB-18336-02 60 µL

NDUFB3 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFB3 Polyclonal Antibody
E-AB-18336-03 120 µL

NDUFB3 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFB3 Polyclonal Antibody
E-AB-18336-04 200 µL

NDUFB3 Polyclonal Antibody

Sign In for Pricing
View Details