Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCIN Peptide - N-terminal region

CCIN Peptide - N-terminal region

Product Specifications

UniProt

Q13939

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005884

Preservative

Lyophilized powder

AA Sequence

VAYSGIRDNFHYWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulforhodamine 101-Alpha-Bungarotoxin, 500 ug
#00015 1x 500 µg

Sulforhodamine 101-Alpha-Bungarotoxin, 500 ug

Sign In for Pricing
View Details
Shisa5 (NM_026381) Mouse Tagged ORF Clone
MG200765 10 µg

Shisa5 (NM_026381) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
alpha Tubulin Mouse Monoclonal Antibody [A8-6]
M1501-1 100 µL

alpha Tubulin Mouse Monoclonal Antibody [A8-6]

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF405S conjugate, 0.1mg/mL
BNC041557-500 1x 500 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF594 conjugate, 0.1mg/mL
BNC943640-100 1x 100 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C19orf2 (URI1) (C-term) Rabbit Polyclonal Antibody
AP11791PU-N 400 µL

C19orf2 (URI1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details