Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCIN Peptide - N-terminal region

CCIN Peptide - N-terminal region

Product Specifications

UniProt

Q13939

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005884

Preservative

Lyophilized powder

AA Sequence

VAYSGIRDNFHYWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl 2-Aminobenzoate
TRC-T205843-5MG 5 mg

tert-Butyl 2-Aminobenzoate

Sign In for Pricing
View Details
Recombinant Human PTGS2/COX2/PGHS-2 Protein (His Tag)
PKSH030929 50 µg

Recombinant Human PTGS2/COX2/PGHS-2 Protein (His Tag)

Sign In for Pricing
View Details
QK1 (QKI) (NM_206855) Human Recombinant Protein
TP315788L 1 mg

QK1 (QKI) (NM_206855) Human Recombinant Protein

Sign In for Pricing
View Details
RAB12 Rabbit Polyclonal Antibody
TA380608 100 µL

RAB12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GelRed® Prestain Plus 6X DNA Loading Dye
#41011 1x 1 mL

GelRed® Prestain Plus 6X DNA Loading Dye

Sign In for Pricing
View Details
2-(1H-Pyrazol-4-yl)aniline
TRC-B530200-10MG 10 mg

2-(1H-Pyrazol-4-yl)aniline

Sign In for Pricing
View Details