CCL16 Peptide - N-terminal region
CCL16 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, MGC117051, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4
UniProt
O15467
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCL16 Rabbit Polyclonal Antibody (orb329583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004581
Preservative
Lyophilized powder
AA Sequence
SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI9C5]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90810e/imageurl/cf807599.webp)
CF807599 100 µg
NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI9C5]
Sign In for Pricing
View Details 
BNC042074-500 1x 500 µL
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
