Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccl20 Peptide - C-terminal region

Ccl20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ST38, Scya20, Ccl20

UniProt

P97884

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccl20 Rabbit Polyclonal Antibody (orb329582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062106

Preservative

Lyophilized powder

AA Sequence

CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human zinc finger, HIT type 1 polyclonal Antibody
MBS713331-01 0.1 mL

Rabbit anti-human zinc finger, HIT type 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human zinc finger, HIT type 1 polyclonal Antibody
MBS713331-02 5x 0.1 mL

Rabbit anti-human zinc finger, HIT type 1 polyclonal Antibody

Sign In for Pricing
View Details
MAGEA12 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2397472 100 µL

MAGEA12 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
TRNAE34P 3'UTR Lenti-reporter-Luc Vector
48001081 1.0 µg

TRNAE34P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
E330009J07Rik AAV siRNA Pooled Vector
18839164 1.0 µg

E330009J07Rik AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mppe1 (NM_001108435) Rat Untagged Clone
RN203136 10 µg

Mppe1 (NM_001108435) Rat Untagged Clone

Sign In for Pricing
View Details