Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccl20 Peptide - C-terminal region

Ccl20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ST38, Scya20, Ccl20

UniProt

P97884

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccl20 Rabbit Polyclonal Antibody (orb329582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062106

Preservative

Lyophilized powder

AA Sequence

CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)
MBS1353782-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)
MBS1353782-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)
MBS1353782-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)
MBS1353782-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)
MBS1353782-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)
MBS1353782-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus Laccase domain protein MW1070 (MW1070)

Sign In for Pricing
View Details